Transfected Stable Cell Lines
Reliable | High-Performance | Wide Rage
Precision reporter, kinase, immune receptor, biosimilar, Cas9, and knockout stable cell lines for diverse applications.
Cat. No. : PMRNL-0005
| Cat. No. | PMRNL-0005 |
| Description | The mCherry mRNA encodes the mCherry fluorescent protein, which can be used as a fluorescent tracer in transfection and transgenic experiments or as a reporter of gene expression. |
| Gene Type | Reporter Gene |
| RNA Type | mRNA |
| Gene Name | mCherry |
| Features |
• mRNA synthesized on error free sequence verified plasmid DNA template • Cap 1 Capping and poly-A tailed incorporated • Degrades the DNA template after RNA synthesis with DNase |
| Sequence | MASKLGSVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKLE |
| Storage | Store at or below -70°C. Avoid repeated freeze/thaw cycles. Aliquot if necessary using RNase-free equipment, reagents, pipet tips, tubes, and containers. |
mRNA-mediated protein replacement therapy represents a promising concept for the treatment of liver diseases. Children born with mutations in fumarylacetoacetate hydrolase (FAH) develop hepatorenal tyrosinemia type 1 (HT-1), which leads to renal dysfunction, liver failure, neurological impairment, and cancer. Protein replacement therapy using FAH mRNA holds promise for curing HT-1 but is currently hampered by the development of effective mRNA vectors that can function in the diseased liver. Structure-guided, rationally optimized 5A2-SC8 mRNA-loaded dendrimer lipid nanoparticles (mDLNPs) improve the delivery of FAH mRNA, resulting in functional FAH protein and sustained restoration of body weight and liver function in FAH-/- knockout mice. Optimization with luciferase mRNA enabled the preparation of DLNP vectors at in vivo doses as low as 0.05 mg kg−1. mDLNPs transfected more than 44% of hepatocytes in the liver, produced high levels of FAH protein (0.5 mg kg−1 mRNA), and were well tolerated in a knockout mouse model of impaired liver function. Genetically engineered FAH-/- mice treated with FAH mRNA mDLNPs had statistically comparable levels of TBIL, ALT, and AST to those of wild-type C57BL/6 mice and maintained normal body weight over a month-long treatment period.
To further understand the delivery of mDLNPs to the liver, the researchers quantified the time-dependent Luc activity after intravenous injection. Luc protein expression peaked at 6 h after injection and remained high for about two days at both the organ (Figure 1A) and systemic levels. Next, they investigated the in vivo dose-response behavior of delivery (Figure 1B). Luc expression increased with increasing doses from 0.05 mg kg−1 to 0.2 mg kg−1 mRNA. The average radiance of the entire liver was calculated and plotted for time-dependency and dose-response studies (Figure 1A, B). With expression levels above 106 photons/second at a dose of 0.05 mg kg−1 mRNA, mDLNPs may be the most efficient mRNA carrier reported to date. Next, the researchers quantified delivery to liver hepatocytes. mCherry mRNA was delivered at a dose of 0.5 mg kg−1, and mCherry expression was compared to that of a PBS-injected control group by fluorescence imaging of liver sections (Figure 1C). Strong red mCherry signals were observed in the liver. To further analyze the transfection efficiency, the researchers isolated hepatocytes from the injected mice and used flow cytometry to quantify the specific delivery of mCherry mRNA to hepatocytes. The researchers found that 44.2% of hepatocytes strongly expressed mCherry protein 6 hours after intravenous injection of mCherry mRNA mDLNPs.
Figure 1. mDLNPs deliver mRNA in a dose-dependent manner with high transfection efficiency of liver hepatocytes. (Cheng Q, et al., 2018)
If your question is not addressed through these resources, you can fill out the online form below and we will answer your question as soon as possible.
Write a review of your use of Biogene products and services in your research. Your review can help your fellow researchers make informed purchasing decisions.