Pages
Products

PSCA


Official Full Name
prostate stem cell antigen
Organism
Homo sapiens
Gene ID
8000
Background
This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010]
Synonyms
PRO232; lncPSCA
Protein Sequence
MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL
Open
Disease
Non-small-cell lung cancer, Pancreatic cancer, Prostate cancer, Solid tumour/cancer, Stomach cancer
Approved Drug
0
Clinical Trial Drug
6 +
Discontinued Drug
0

Detailed Information

The Prostate Stem Cell Antigen (PSCA) gene is located on human chromosome 8q24.3, spanning approximately 15 kb with three exons. Its promoter region contains functional polymorphic sites, such as rs2294008 (C>T), which influence transcription start site selection and tissue-specific expression. The PSCA protein is a glycosylphosphatidylinositol (GPI)-anchored membrane protein belonging to the Ly-6/Thy-1 superfamily. It contains a conserved LU domain with ten cysteines forming five disulfide bonds, an N-terminal signal sequence, and a C-terminal GPI-anchoring signal. This structure allows PSCA to localize to lipid raft microdomains, mediating cell signaling and adhesion. In normal tissues, PSCA expression is highly tissue-specific: high in prostate basal cells, moderate in bladder urothelium and placental trophoblast, and restricted to the pyloric glands in the gastrointestinal tract, suggesting context-dependent biological roles.

PSCA expression is regulated by both genetic and epigenetic mechanisms. The rs2294008 T allele produces an extended 5′UTR, reducing protein expression by 40–60% and correlating with a 2.14-fold increased risk of gastric cancer. Promoter methylation further modulates PSCA expression: hypomethylation drives overexpression in 71% of bladder cancers, whereas hypermethylation silences PSCA in 60% of gastric cancers. Tissue-specific transcription factors, such as FOXA1 in prostate and PPARγ in bladder, also contribute to PSCA regulation. Additionally, PSCA can be cleaved by metalloproteases ADAM10/17, generating a soluble form (sPSCA, ~25 kDa) detectable in serum and associated with higher metastatic risk in prostate cancer, making it a potential liquid biopsy biomarker.

Figure 1. Prostate Stem Cell AntigenFigure 1. Prostate Stem Cell Antigen (PSCA) is a GPI-anchored surface protein identified in human prostate cancer xenografts, lacking transmembrane and cytoplasmic domains. (Figure source: UniProt)

Physiological and Pathological Functions

PSCA exhibits context-dependent effects. In the prostate, PSCA functions as a proliferation suppressor by interfering with the Wnt/β-catenin pathway (reducing β-catenin nuclear translocation) and inhibiting EGFR dimerization, contributing to tumor suppression. In contrast, in pancreas and bladder, PSCA can promote cancer progression. In pancreatic cancer, PSCA overexpression activates MAPK and Akt signaling, enhancing proliferation and invasion, and correlates with advanced TNM stage and lymph node metastasis.

Genetic polymorphisms further influence cancer susceptibility. Carriers of the rs2294008-TT genotype have a 3.03-fold increased risk of hepatocellular carcinoma (HCC), with evidence that high HBV viral load mediates a significant portion of this effect, providing molecular support for gene-environment interactions. In gastric cancer, rs2294008-T is associated with diffuse-type pathology.

Within the tumor microenvironment, PSCA contributes to immune modulation. Overexpression recruits myeloid-derived suppressor cells (MDSCs), promotes M2 macrophage polarization, and upregulates PD-L1, reducing anti-PD-1 therapy response. Soluble sPSCA can bind CD16 on natural killer cells, inhibiting ADCC and contributing to therapeutic resistance.

Diagnostic and Therapeutic Applications

PSCA is a validated biomarker across multiple cancers. In pancreatic cancer, combining serum sPSCA with CA19-9 improves early detection sensitivity to 92%, particularly in CA19-9-negative patients. Urinary PSCA detection in bladder cancer demonstrates high sensitivity (85%) when combined with nanomagnetic enrichment. Imaging applications, such as [^89Zr]DFO-hu1G8 PET-CT, allow visualization of sub-5 mm prostate cancer metastases, correlating with PSCA expression.

Therapeutically, PSCA-targeting strategies include monoclonal antibodies (AGS-1C4D4), bispecific antibodies (PSCAxCD3), antibody-drug conjugates (PSCA-ADC), and CAR-T cells. Third-generation PSCA-CAR-T cells incorporating 4-1BB co-stimulatory domains improve bone metastasis symptoms and reduce circulating tumor cells, while gene editing optimizes tumor infiltration and immune activation. DNA vaccines targeting PSCA elicit antigen-specific humoral and cellular responses in preclinical and early clinical studies.

Challenges and Future Directions

Challenges in PSCA-targeted therapy include antigen escape, on-target off-tumor toxicity, and microenvironment-mediated immunosuppression. Epigenetic modulators can restore PSCA expression to enhance therapeutic durability, while optimized dosing and local delivery reduce side effects. Future directions emphasize precise patient stratification using PSCA expression, isoform ratios, sPSCA concentration, and genetic polymorphisms to predict treatment response. Combining PSCA-targeted therapy with immune checkpoint inhibitors demonstrates synergistic potential, achieving high tumor clearance and long-term immune memory in preclinical models.

PSCA functions as a molecular nexus linking membrane topology to cellular fate, providing insights into cancer biology, biomarker development, and regenerative medicine. Structural elucidation of PSCA-antibody complexes and signaling networks will enable the next generation of precision therapeutics with spatiotemporal control, ultimately improving outcomes in prostate, pancreatic, and bladder cancers.

Reference

  1. Nayerpour Dizaj T, Doustmihan A, Sadeghzadeh Oskouei B, et al. Significance of PSCA as a novel prognostic marker and therapeutic target for cancer. Cancer Cell Int. 2024 Apr 16;24(1):135

  2. Zhang J, Chadha JS. Developmental Therapeutics in Metastatic Prostate Cancer: New Targets and New Strategies. Cancers (Basel). 2024 Sep 6;16(17):3098.

Quick Inquiry