Pages
Products

MAPK14


Official Full Name
mitogen-activated protein kinase 14
Organism
Homo sapiens
Gene ID
1432
Background
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Synonyms
RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA
Bio Chemical Class
Kinase
Protein Sequence
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Open
Disease
Alzheimer disease, Chronic obstructive pulmonary disease, Coronary atherosclerosis, Intrathoracic organs injury, Myocardial infarction, Pain, Postoperative inflammation, Psoriasis, Retinopathy, Rheumatoid arthritis, Solid tumour/cancer, Vitamin deficiency
Approved Drug
0
Clinical Trial Drug
5 +
Discontinued Drug
8 +

Cat.No. Product Name Price
SHH175457 shRNA set against Rat Mapk14(NM_031020.2) Inquiry
SHH337980 shRNA set against Human MAPK14 (NM_001315.2) Inquiry
SHH337983 shRNA set against Mouse MAPK14 (NM_011951.3) Inquiry
SHH337987 shRNA set against Rat MAPK14 (NM_031020.2) Inquiry
SHW015129 shRNA set against Danio rerio MAPK14A (NM_131722) Inquiry
SHW015467 shRNA set against Danio rerio MAPK14B (NM_178223) Inquiry
Cat.No. Product Name Price
SKO0586 MAPK14 Validated sgRNA vector Inquiry
MiUTR3H-03249 MAPK14 miRNA 3'UTR clone Inquiry
MiUTR1R-03682 MAPK14 miRNA 3'UTR clone Inquiry
CDFR012496 Rat Mapk14 cDNA Clone(NM_031020.2) Inquiry
CDFG021130 Mouse Mapk14 cDNA Clone(NM_001168508.1) Inquiry
CDCS410224 Human MAPK14 ORF Clone (BC000092) Inquiry
MiUTR4H-TG05357 MAPK14 miRNA 3'UTR clone Inquiry
CDCR379518 Rat Mapk14 ORF Clone(NM_031020.2) Inquiry
CDCR241815 Mouse Mapk14 ORF Clone(NM_001168514.1) Inquiry
CDCR241812 Mouse Mapk14 ORF Clone(NM_001168508.1) Inquiry
CDCL185266 Human MAPK14 ORF clone(NM_001315.2) Inquiry
CDCL151346 Mouse Mapk14 ORF clone (NM_001168513.1) Inquiry
CDCB196250 Rabbit LOC103350238 ORF clone (XM_008265540.1) Inquiry
CDCB196249 Rabbit LOC103350240 ORF clone (XM_008265553.1) Inquiry
CDCB180915 Rabbit MAPK14 ORF clone (XM_002714646.2) Inquiry
CDCB176942 Danio rerio MAPK14B ORF Clone (NM_178223) Inquiry
CDCL185267 Mouse MAPK14 ORF clone(NM_011951.3) Inquiry
CDCB176604 Danio rerio MAPK14A ORF Clone (NM_131722) Inquiry

Detailed Information

The MAPK14 (Mitogen-Activated Protein Kinase 14) gene is located at chromosomal region 6p21.3 and encodes the p38α protein, a key member of the mitogen-activated protein kinase (MAPK) family. As an integrative node within cellular signal transduction networks, it plays a crucial role in regulating cellular proliferation, differentiation, transcription, and development. The gene undergoes alternative splicing to produce at least four transcript variants. Variant 1 (NM_001315) encodes isoform 1, consisting of 360 amino acids, while variant 4 (NM_139014) encodes a shorter isoform of 307 amino acids due to internal deletions. These structural differences result in significant functional divergence in kinase activity and substrate specificity.

The MAPK14 protein structure comprises a conserved N-terminal ATP-binding pocket, a central kinase domain (containing the dual phosphorylation motif Thr180/Tyr182 within the activation loop), and a C-terminal auto-inhibitory domain. Its activation follows two primary pathways: the classical pathway, dependent on phosphorylation by upstream MAP2Ks (MKK3/6), and a non-canonical pathway involving TAB1-mediated autophosphorylation, which is especially critical in osmotic stress responses in cardiomyocytes. The MAPK14 substrate network is extensive, including transcription factors (e.g., ATF2, MEF2C, p53), cell cycle regulators (CDC25B, CDC25C), RNA-binding proteins (such as ZFP36, which modulates mRNA stability), and cytoskeletal components. This multi-target profile underscores its role as a central mediator linking environmental stimuli to cellular responses.

Figure 1. MAPK signalling in pathogenesis. (Fang JY, et al., 2005)

Biological Functions and Regulatory Mechanisms

MAPK14 plays a pivotal role in stress responses and immune regulation. Upon exposure to environmental stressors such as UV radiation or osmotic pressure changes, or in response to pro-inflammatory cytokines like TNF-α and IL-1β, MAPK14 is rapidly activated. It phosphorylates downstream effectors to orchestrate a broad range of physiological responses. In inflammatory signaling, for instance, MAPK14 promotes the shedding of the TGF-α ectodomain by phosphorylating the metalloprotease ADAM17, thereby enhancing EGFR pathway activation. Under oxidative stress, MAPK14 phosphorylates S100A9 at Thr113, enhancing its interaction with TLR4 and promoting macrophage recruitment to inflamed sites.

Recent findings by Cheng Haibo's group in 2025 revealed a novel role of MAPK14 in remodeling the tumor immune microenvironment. In colorectal cancer models, the natural compound lobeline was shown to bind directly to the Lys53 residue of MAPK14, preventing its nuclear translocation. This inhibition led to reduced phosphorylation of p53 at Ser15 and subsequently activated the expression of SLURP1 (Secreted LY6/PLAUR Domain Containing 1), an immunomodulatory protein. SLURP1 enhances the polarization of tumor-associated macrophages (TAMs) toward the anti-tumorigenic M1 phenotype while suppressing the pro-tumorigenic M2 phenotype. This immune reprogramming significantly improved the efficacy of anti-PD-1 antibody therapy, offering a new strategy for combination immunotherapy.

At the epigenetic level, MAPK14 modulates gene expression via two mechanisms: first, it phosphorylates histone H3 at Ser10 (H3S10ph), increasing chromatin accessibility and promoting NF-κB recruitment to inflammatory gene promoters (e.g., IL6, IL8); second, it forms a glucose-sensing complex with O-GlcNAc transferase (OGT), enhancing OGT-mediated modification of neurofilament H under low-glucose conditions. This post-translational modification competes with phosphorylation to regulate cytoskeletal dynamics.

MAPK14 also plays a key role in mitochondrial function. Under UV-B exposure, MAPK14 activates the NLRP1 inflammasome via MAP3K20/ZAK-mediated phosphorylation, inducing pyroptosis, a process implicated in skin carcinogenesis.

Disease Associations and Molecular Mechanisms

Aberrant MAPK14 signaling is implicated in a variety of diseases, particularly cancers and inflammatory conditions:

Gastric Cancer and Tumor-Suppressive Role of circMAPK14

In 2024, studies revealed significantly lower expression of the circular RNA circMAPK14 (hsa_circ_24603) in gastric cancer tissues compared to adjacent normal tissues. Its expression was inversely correlated with tumor progression. Mechanistically, circMAPK14 acts as a molecular sponge for miR-330-5p, thereby relieving its repression of MAPK14 mRNA. When circMAPK14 expression is downregulated, miR-330-5p is upregulated, inhibiting MAPK14 translation and triggering two key outcomes: decreased MAPK14 phosphorylation reduces p53 activation, and pro-apoptotic genes (Bax, Puma, Noxa) are downregulated. Functional assays in SGC7901 cells showed enhanced proliferation, increased migration, and resistance to TBH-induced apoptosis upon circMAPK14 knockdown. Additionally, circMAPK14 deficiency promoted epithelial-mesenchymal transition (EMT), increasing lymph node metastasis risk.

Placental Development Disorders

Knockout studies in mice have demonstrated that MAPK14 is essential for vascular development in the labyrinth layer of the placenta during mid-gestation. Its absence leads to defective embryonic vasculature, reduced exchange surface area, intrauterine growth restriction (IUGR), and embryonic lethality. This effect is linked to impaired expression of erythropoietin (EPO), where MAPK14 phosphorylates the transcription factor C/EBPβ at the EPO enhancer to regulate its activity.

Immune Evasion by Pathogens

Mycobacterium tuberculosis employs its virulence factor EsxA to phosphorylate MAPK14 within T cells, suppressing IFN-γ production within 15 minutes of infection and weakening host immunity. Clinical isolates show a correlation between EsxA phosphorylation efficiency and pathogenicity, suggesting MAPK14 as a potential therapeutic target in tuberculosis.

Table: Roles and Clinical Relevance of MAPK14 in Human Diseases

Disease TypeMolecular AbnormalityKey Pathological MechanismClinical Association / Therapeutic Implication
Gastric cancerLow circMAPK14 expressionmiR-330-5p-mediated suppression of MAPK14, reduced apoptosisPoor prognosis marker; potential for circMAPK14 mimetic therapy
Colorectal cancerIncreased MAPK14 nuclear translocationAbnormal p53 phosphorylation, immunosuppressive microenvironmentSynergistic effect of lobeline with anti-PD-1 therapy
Placental dysfunctionGene deletion / loss of functionImpaired EPO expression and angiogenesisReduced MAPK14 expression in preeclamptic placentas
TuberculosisEsxA-mediated MAPK14 phosphorylationIFN-γ suppressionRisk of exacerbating infection with MAPK14 inhibitors

Therapeutic Strategies and Future Perspectives

MAPK14-targeted therapies are evolving in a disease-specific manner:

Inflammatory Diseases: Traditional p38 inhibitors like SB203580 act via ATP-binding site inhibition. While they reduce inflammatory markers in clinical trials for rheumatoid arthritis, their long-term efficacy is limited by compensatory pathway activation. Next-generation allosteric inhibitors (e.g., Skepinone-L) target the kinase's C-terminal regulatory domain to enhance isoform selectivity and reduce toxicity.

Cancer Therapy: Natural compounds such as lobeline offer a novel mechanism for MAPK14 inhibition. Cheng Haibo's team showed that lobeline binds MAPK14 at Lys53, disrupting its interaction with importin-α and preventing nuclear translocation. This shift in subcellular localization alters the p53 phosphorylation pattern from Ser15 to Ser46, enhancing transcription of the pro-apoptotic gene PUMA. In colorectal cancer organoid models, lobeline (50 μM) enhanced PD-1 antibody efficacy by 3.2-fold. This synergy arises from MAPK14 inhibition–induced effects, including increased CD8+ T cell infiltration, M1 macrophage polarization, and PD-L1 downregulation.

circRNA Replacement Therapy: In gastric cancer, restoration of circMAPK14 using liposome-encapsulated mimetics successfully increased MAPK14 levels and reduced tumor volume by 58% in animal models. This approach minimizes systemic toxicity associated with gene overexpression, enabling precise local intervention.

The principal challenge ahead lies in balancing MAPK14's dual role: tumor suppression in early stages versus promotion of inflammatory mediators in established tumor microenvironments. Potential solutions include microenvironment-responsive nanocarriers (e.g., pH-sensitive liposomes) and targeting tissue-specific splice variants such as EXIP, which has distinct functions in apoptosis initiation.

As a central hub linking stress responses to immune regulation, MAPK14 remains a promising target across oncology, inflammatory, and infectious diseases. Continued dissection of its multifaceted roles will pave the way for next-generation precision therapies.

References:

  1. Madkour MM, Anbar HS, El-Gamal MI. Current status and future prospects of p38α/MAPK14 kinase and its inhibitors. Eur J Med Chem. 2021 Mar 5;213:113216.
  2. Ding QY, Zhang Y, Ma L, et al. Inhibiting MAPK14 showed anti-prolactinoma effect. BMC Endocr Disord. 2020 Sep 7;20(1):138.
  3. Fang JY, Richardson BC. The MAPK signalling pathways and colorectal cancer. Lancet Oncol. 2005 May;6(5):322-7.
Quick Inquiry