Pages
Products

HMGB1


Official Full Name
high mobility group box 1
Organism
Homo sapiens
Gene ID
3146
Background
This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]
Synonyms
HMG1; HMG3; HMG-1; SBP-1
Protein Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Open
Approved Drug
0
Clinical Trial Drug
0
Discontinued Drug
0

Cat.No. Product Name Price
SHH125039 shRNA set against Rat Hmgb1(NM_012963.2) Inquiry
SHH125057 shRNA set against Mouse Hmgb1(NM_010439.3) Inquiry
SHH125075 shRNA set against Human HMGB1(NM_002128.4) Inquiry
SHW005407 shRNA set against Chicken HMGB1 (NM_204902) Inquiry
Cat.No. Product Name Price
RP00659 Recombinant Human HMGB1 (C-His) Inquiry
Cat.No. Product Name Price
CDCR377808 Rat Hmgb1 ORF Clone(NM_012963.2) Inquiry
CDCS410635 Human HMGB1 ORF Clone (BC030981) Inquiry
CDFH008607 Human HMGB1 cDNA Clone(NM_002128.4) Inquiry
CDFR010661 Rat Hmgb1 cDNA Clone(NM_012963.2) Inquiry
MiUTR1H-04601 HMGB1 miRNA 3'UTR clone Inquiry
MiUTR1M-05695 HMGB1 miRNA 3'UTR clone Inquiry
MiUTR1R-02449 HMGB1 miRNA 3'UTR clone Inquiry
CDCB166882 Chicken HMGB1 ORF Clone (NM_204902) Inquiry
CDCB180657 Rabbit HMGB1 ORF clone (XM_008273516.1) Inquiry
CDCL184596 Human HMGB1 ORF clone(NM_002128.4) Inquiry
CDCL184597 Mouse HMGB1 ORF clone(NM_010439.3) Inquiry
CDCS410634 Human HMGB1 ORF Clone (BC003378) Inquiry

Detailed Information

High mobility group Box 1 protein (HMGB1) is a nuclear protein that acts as a DNA chaperone and participates in many activities in the nucleus, including replication, transcription, DNA repair and nucleosome assembly. Apart from its roles in the nucleus, HMGB1 can also translocate to the cytoplasm, where it can activate autophagy by interacting with beclin-1, and to the extracellular medium, where it acts as a DAMP (Damage Associated Molecular Pattern) molecule that alerts nearby cells and the immune system to immediate danger, triggering inflammation. HMGB1 has emerged as one of the main mediators in both acute and chronic inflammation, and thus plays a role in an impressive number of medical conditions.

Besides effects on immune cells, HMGB1 can modulate the activities of epithelial, hematopoietic and neuronal cells and mediate systemic effects such as fever, anorexia, and acute-phase responses. These activities reflect its function as an alarmin and its ability to engage diverse receptors including TLR2, TLR4, TLR9, CD24- Siglec-10 and RAGE (receptor for advanced glycation end products). In these interactions, post-translational modifications of HMGB1, including phosphorylation, acetylation, methylation and redox changes of cysteine residues, can influence the receptor interactions and downstream signaling events.

Signaling by HMGB1.Figure 1. Signaling by HMGB1. (Harris H E, et al. 2012)

The Dual Roles of HMGB1 in Cancer

Over the past two decades, HMGB1 has been demonstrated as one of the major players in many cancers including colon, breast, lung, kidney, stomach, prostate, cervical, skin, pancreatic, liver, bone, and blood cancer. HMGB1 acts as both a tumor suppressor and an oncogenic factor in tumorigenesis and cancer therapy relying on the context and the study conditions, as well as HMGB1 location and modification.

The tumor microenvironment consists of tumor cells and nontumor cells, including multiple immune cells. HMGB1 can be released, including through autocrine from the tumor cells and the surrounding cells under hypoxia or other environmental stimuli. Extracellular HMGB1 mediates communication between cells in the tumor microenvironment by various receptors (e.g., TLR4 and RAGE), which contributes to tumor growth and spreads by several mechanisms including sustenance of the inflammatory microenvironment, fulfillment of metabolic requirements, promotion of invasion and metastasis, inhibition of antitumor immunity, and promotion of angiogenesis. Therefore, inhibition of HMGB1 release and activity can block tumor growth and development.

Several studies show that intracellular HMGB1 may be a tumor suppressor. For example, nuclear HMGB1 binds to tumor suppressor RB, which results in RB-dependent G1 arrest and apoptosis induction and prevents tumorigenicity in breast cancer cells in vitro and in vivo. Nuclear HMGB1 is an important architectural factor with DNA chaperone activity. Loss of HMGB1 results in genome instability with telomere shortening, which is a major driving force in tumorigenesis. In addition, recent studies suggest that deficiencies of autophagy gene (e.g., ATG5, Beclin-1, UVRAG, Bif-1) increase tumorigenesis due to genome instability, inflammation, an organelle injury. Given that HMGB1 is a positive regulator of autophagy, HMGB1 deficiency causing autophagy dysfunction may lead to genome instability and inflammation, which promotes tumorigenesis.

The dual roles of HMGB1 in cancer.Figure 2. The dual roles of HMGB1 in cancer. (Kang R, et al. 2013)

HMGB1's Protective Roles in Anticancer Therapy

HMGB1-mediated immunogenic cell death (ICD) contributes to immune-mediated eradication of tumors during chemotherapy or radiotherapy. ICD is characterized by the release of dying cancer cells or cell surface exposure of DAMPs (e.g., calreticulin, HSPs, HMGB1, and ATP), which are helpful for the maturation, antigen uptake, and presentation of dendritic cells and serve as powerful immunologic adjuvants to active CTL response. Autophagy-mediated ATP release also contributes to ICD development. Blocking the HMGB1-TLR4 pathway inhibits ICD-associated anticancer immune responses upon chemotherapy in vitro and in vivo. However, HMGB1 released from necrotic cancer cells treated with chemotherapy enhances regrowth and metastasis of remnant cancer cells in a RAGE-dependent way. Therefore, blocking HMGB1–RAGE signaling increases the effectiveness of chemotherapy.

HMGB1's Negative Roles in Anticancer Therapy

Induction of cell death and inhibition of cell growth are the main targets of cancer therapy. Many studies have shown that suppression of HMGB1 expression by RNA interference increased the anticancer activity of cytotoxic agents, whereas overexpression of HMGB1 expression by gene transfection increased drug resistance. HMGB1 expression regulates chemotherapeutic response and resistance by interfering with autophagy and the apoptotic pathway. HMGB1 increases prosurvival autophagy in a Beclin 1-dependent way in chemotherapy, whereas HMGB1 inhibits both extrinsic and intrinsic programmed cell death/apoptosis in a caspase-dependent way in cancer cells. In some cases, knockout HMGB1 in fibroblasts inhibits antimetabolite drug-induced apoptosis, indicating that HMGB1 plays a distinct role in apoptosis depending on cell types. The cross-talk between apoptosis and autophagy regulates cell death and determines cell fate in anticancer therapy.

References:

  1. Harris H E, et al. HMGB1: a multifunctional alarmin driving autoimmune and inflammatory disease. Nature Reviews Rheumatology, 2012, 8(4): 195.
  2. Venereau E, et al. HMGB1 as biomarker and drug target. Pharmacological research, 2016, 111: 534-544.
  3. Kang R, et al. HMGB1 in cancer: good, bad, or both?. Clinical cancer research, 2013, 19(15): 4046-4057.
  4. Kang R, et al. HMGB1 in health and disease. Molecular aspects of medicine, 2014, 40: 1-116.
Quick Inquiry