Pages
Products

COP1


Official Full Name
COP1 E3 ubiquitin ligase
Organism
Homo sapiens
Gene ID
64326
Background
Enables ubiquitin protein ligase activity. Involved in positive regulation of proteasomal ubiquitin-dependent protein catabolic process; proteasome-mediated ubiquitin-dependent protein catabolic process; and response to ionizing radiation. Part of Cul4A-RING E3 ubiquitin ligase complex. [provided by Alliance of Genome Resources, Feb 2025]
Synonyms
FAP78; RFWD2; CFAP78; RNF200
Bio Chemical Class
Acyltransferase
Protein Sequence
MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGGLGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLCNGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMSGLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRLTAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
Open

Cat.No. Product Name Price
SHG192385 shRNA set against Human COP1(NM_001017534.1) Inquiry
SHG192403 shRNA set against Human COP1(NM_052889.2) Inquiry
SHH254701 shRNA set against Human CARD16 (NM_052889.2) Inquiry
SHH392364 shRNA set against Human RFWD2 (NM_022457.5) Inquiry
SHH392368 shRNA set against Mouse RFWD2 (NM_011931.3) Inquiry
SHH392372 shRNA set against Rat RFWD2 (NM_001025126.1) Inquiry
SHR177594 shRNA set against Mouse Rfwd2(NM_011931.3) Inquiry
SHR177680 shRNA set against Human RFWD2(NM_022457.5) Inquiry
SHR177698 shRNA set against Human RFWD2(NM_001001740.2) Inquiry
SHW011513 shRNA set against Danio rerio RFWD2 (NM_001089542) Inquiry
Cat.No. Product Name Price
CDCB172988 Danio rerio RFWD2 ORF Clone (NM_001089542) Inquiry
MiUTR1M-10048 RFWD2 miRNA 3'UTR clone Inquiry
MiUTR1H-08760 RFWD2 miRNA 3'UTR clone Inquiry
MiUTR1H-02351 CARD16 miRNA 3'UTR clone Inquiry
MiUTR1H-02350 CARD16 miRNA 3'UTR clone Inquiry
CDFR003854 Rat Rfwd2 cDNA Clone(NM_001025126.1) Inquiry
CDFH016210 Human RFWD2 cDNA Clone(NM_001001740.2) Inquiry
CDFH002706 Human CARD16 cDNA Clone(NM_001017534.1) Inquiry
MiUTR1R-06421 RFWD2 miRNA 3'UTR clone Inquiry
CDFG007006 Human CARD16 cDNA Clone(NM_052889.2) Inquiry
CDCH073196 Mouse Rfwd2 ORF clone (NM_011931.3) Inquiry
CDFG003747 Human RFWD2 cDNA Clone(NM_022457.5) Inquiry
MiUTR3H-09713 RFWD2 miRNA 3'UTR clone Inquiry
CDCR370878 Rat Rfwd2 ORF Clone(NM_001025126.1) Inquiry
CDCR041452 Human CARD16 ORF clone (NM_001017534.1) Inquiry
CDCR041450 Human CARD16 ORF clone (NM_052889.2) Inquiry
CDCH073194 human RFWD2 ORF clone (NM_001001740.2) Inquiry
CDCH073192 human RFWD2 ORF clone (NM_022457.5) Inquiry
CDCB183985 Rabbit RFWD2 ORF clone (XM_008263809.1) Inquiry

Detailed Information

COP1 (Constitutive Photomorphogenic 1, RFWD2) is a crucial E3 ubiquitin ligase responsible for mediating the ubiquitination and subsequent proteolysis of target proteins. It plays vital roles in processes such as cell proliferation, cell cycle progression, transcription regulation, and apoptosis, particularly significant in tumorigenesis, cell repair, and regulation. The study of the COP1 gene has revealed its highly conserved structure and function across various cell organisms and its relationship with diseases like cancer, making it a hot topic in molecular biology research.

Basic Functions and Structural Features of COP1

The COP1 gene is located on human chromosome 1q24.1 and encodes a COP1 protein primarily composed of three highly conserved domains: an N-terminal RING finger domain, a coiled-coil region, and a C-terminal 7 WD40 repeat domain. COP1's E3 ubiquitin ligase function depends on the RING finger domain, which helps to transport active ubiquitin molecules to target proteins using E2 ubiquitin-conjugating enzymes therefore completing the ubiquitination process. Key to the WD40's activity is its repeated mediation of COP1's interactions with its target proteins. Important for its function in cell cycle control and response to external stimuli, COP1 also includes nuclear localization signals (NLS) and nuclear export signals (NES), which lets it shuttle between the nucleus and cytoplasm.

COP1 functions not only through its RING domain's direct action on substrates but also by forming complexes with other proteins to mediate protein degradation indirectly. For instance, a large complex comprising COP1 with CUL4A and DDB1 regulates the degradation of substrates such as c-Jun, demonstrating its diverse regulatory modes.

Figure 1 illustrates how blue light suppresses the activity of the COP1/SPA E3 ligase in plants.Figure 1. Blue light suppression of COP1/SPA E3 ligase promotes photomorphogenesis. (Ponnu J, 2020)

Dual Role of COP1 in Cancer

COP1 can either promote or inhibit tumorigenesis, depending on the target proteins and the specific context of its expression. Studies have shown that COP1 is overexpressed in many tumors, including leukemia, lymphoma, melanoma, glioma, breast cancer, lung cancer, and colorectal cancer. Overexpressed COP1 can promote cancer cell proliferation and inhibit apoptosis, facilitating tumor progression.

For example, COP1 suppresses the tumor suppressor function of p53 by ubiquitinating and degrading it, promoting cancer cell survival. In glioma cells, COP1 upregulation reduces p53 levels, accelerating cell proliferation. Similarly, COP1 overexpression promotes tumor progression in chronic lymphocytic leukemia (CLL) and hepatocellular carcinoma (HCC).

COP1's regulation of c-Jun also indicates its oncogenic role. c-Jun is a key transcription factor involved in regulating cell proliferation and stress responses. By ubiquitinating and degrading c-Jun, COP1 regulates cell growth and apoptosis, highlighting its central role in intracellular signaling.

However, COP1 may also have inhibitory roles in some tumors through other pathways. For instance, COP1 gene deletion in certain mouse models leads to embryonic lethality and cardiac abnormalities, indicating COP1's critical importance for organism survival. Moreover, some studies suggest COP1 may suppress tumorigenesis by regulating tumor suppressors like p27 and 14-3-3σ.

Target Proteins and Mechanisms of COP1

COP1 targets a variety of proteins, including p53, p27, c-Jun, and 14-3-3σ, which play crucial roles in the cell cycle, transcriptional regulation, and apoptosis. Through its E3 ubiquitin ligase activity, COP1 ubiquitinates these proteins, mediating their degradation and regulating cell growth, division, and death.

p53 Protein: p53 is a well-known protein that helps prevent tumors by controlling the cell cycle and starting the process of cell death. COP1 works directly with p53 using its RING finger part. This action leads to the tagging of p53 for destruction, which reduces its ability to fight tumors. In different types of cancer, high levels of COP1 are linked to lower amounts of p53 protein. This shows that COP1 is important in the development of tumors.

p27 Protein: p27 is a negative regulator of the cell cycle, especially crucial during the transition from the G0/G1 phase to the S phase. COP1 accelerates the cell cycle by directly binding to p27, promoting its polyubiquitination and degradation. This role has been confirmed in multiple cancers, such as breast cancer and osteosarcoma, correlating with tumor malignancy.

c-Jun Protein: c-Jun is an important transcription factor involved in cell growth and stress response control. COP1 helps tumors grow by breaking down c-Jun through a process called ubiquitination. High levels of c-Jun are often linked to the growth and spread of cancer cells, and COP1's role in regulating c-Jun presents a new target for cancer treatment.

14-3-3σ and C/EBPα: By targeting tumor suppressors like 14-3-3σ and C/EBPα, COP1 promotes their degradation, affecting tumor cell growth and differentiation. The degradation of these target proteins plays a regulatory role in tumor progression, demonstrating COP1's dual role in cancer.

Clinical Significance and Future Research Directions for COP1

The mechanism of action of COP1 as an E3 ubiquitin ligase provides new perspectives for cancer treatment. Modulating COP1 activity can effectively control cancer-associated signaling pathways, thereby inhibiting tumor growth or promoting tumor cell death. COP1 inhibitors hold promise as a novel anti-cancer therapy, particularly in cancers with p53 inactivation and other tumor suppressor impairments, as they may restore the functions of these tumor suppressors.

Additionally, the selectivity of COP1 targets offers great potential as a therapeutic target. As more is learned about COP1's mechanism and target proteins through further research, we are likely to discover more COP1 targets, providing a basis for precision cancer therapy. Future research should focus on unveiling the details of COP1's regulatory network and how to leverage this network to develop innovative cancer treatments.

References:

  1. Song Y, Liu Y, et al. Role of the COP1 protein in cancer development and therapy. Semin Cancer Biol. 2020 Dec;67(Pt 2):43-52.
  2. Ponnu J. Molecular mechanisms suppressing COP1/SPA E3 ubiquitin ligase activity in blue light. Physiol Plant. 2020;169(3):418-429.
  3. Hoecker U. The activities of the E3 ubiquitin ligase COP1/SPA, a key repressor in light signaling. Curr Opin Plant Biol. 2017 Jun;37:63-69.
Quick Inquiry