Pages
Products

CNR1


Official Full Name
cannabinoid receptor 1
Organism
Homo sapiens
Gene ID
1268
Background
This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. [provided by RefSeq, May 2009]
Synonyms
CB1; CNR; CB-R; CB1A; CB1R; CANN6; CB1K5
Bio Chemical Class
GPCR rhodopsin
Protein Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Open
Disease
Acute diabete complication, Anorexia nervosa, Cannabis use disorder, Central nervous system disease, Cerebral ischaemia, Chronic kidney disease, Colorectal cancer, General pain disorder, Hypertension, Inborn lipid metabolism error, Insomnia, Ischemia, Low bone mass disorder, Metabolic disorder, Nausea/vomiting, Nicotine use disorder, Obesity, Ovarian cancer, Pain, Prostate cancer, Psychoactive substances use disorder, Psychotic disorder, Schizophrenia, Type 2 diabetes mellitus, Urinary tract infection, Zoster
Approved Drug
4 +
Clinical Trial Drug
12 +
Discontinued Drug
14 +

Cat.No. Product Name Price
VLP-N-00040 Human CNR1 Virus-Like Particles Inquiry
Cat.No. Product Name Price
SHG170065 shRNA set against Mouse Cnr1(NM_007726.3) Inquiry
SHH266577 shRNA set against Rat Cnr1 (NM_012784.4) Inquiry
SHW017972 shRNA set against Danio rerio CNR1 (NM_212820) Inquiry
SHH266569 shRNA set against Human Cnr1 (NM_016083.4) Inquiry
SHH266573 shRNA set against Mouse Cnr1 (NM_007726.3) Inquiry
SHW002256 shRNA set against Chicken CNR1 (NM_001038652) Inquiry
Cat.No. Product Name Price
CDCB193748 Rabbit CNR1 ORF clone (XM_008263199.1) Inquiry
CDCR048904 Human CNR1 ORF clone (NM_016083.4) Inquiry
CDCR048908 Mouse Cnr1 ORF clone (NM_007726.3) Inquiry
CDCR353912 Human CNR1 ORF Clone(NM_001160258.1) Inquiry
CDFG006682 Human CNR1 cDNA Clone(NM_033181.3) Inquiry
CDFH003968 Human CNR1 cDNA Clone(NM_001160226.1) Inquiry
CDFH003969 Human CNR1 cDNA Clone(NM_001160258.1) Inquiry
CDFH003971 Human CNR1 cDNA Clone(NM_001160259.1) Inquiry
CDFR010586 Rat Cnr1 cDNA Clone(NM_012784.4) Inquiry
CDCB163731 Chicken CNR1 ORF Clone (NM_001038652) Inquiry
CDCB179447 Danio rerio CNR1 ORF Clone (NM_212820) Inquiry
CDCR048902 Human CNR1 ORF clone (NM_033181.3) Inquiry
CDCR353745 Human CNR1 ORF Clone(NM_001160226.1) Inquiry
CDCR353913 Human CNR1 ORF Clone(NM_001160259.1) Inquiry
CDCR377644 Rat Cnr1 ORF Clone(NM_012784.4) Inquiry

Detailed Information

Specifically, the type 1 (CB1) cannabinoid receptor, the CNR1 gene codes for Being members of the G protein-coupled receptor (GPCR) family, cannabis receptors mainly control neuronal transmission processes by influencing adenylate cyclase activity. Widely found in the central nervous system (CNS), the CB1 receptor has strong expression in important brain areas including the cerebral cortex, hippocampal region, and hypothalamus. Mostly by binding to the CB1 receptor, which is a basic cause of the psychoactive effects of cannabis, cannabinoids—especially tetrahydrocannabinol (THC) and their synthetic analogs—the main psychoactive components of cannabis—cause different physiological and psychological effects including changes in mood and cognition.

Figure 1 illustrates the impact of chronic stress on the epigenetic regulation of the CNR1 gene, which encodes the CB1 receptor.Figure 1. Epigenetic changes in CNR1 gene regulation due to chronic stress. (Sharkey KA, et al., 2016)

CB1 receptors are found not just in the central nervous system but also in the peripheral nervous system, especially in the digestive system where they are widely distributed. Research shows that CB1 receptors are present in cells in the gut, nerves, and digestive hormone-producing cells. This suggests that cannabis might play a role in managing digestion, appetite, and gut activities. Activating CB1 receptors usually lowers the amounts of cyclic adenosine monophosphate (cAMP). This can impact not only how we manage our hunger but also our memory, pain perception, anxiety, and chronic pain, thus changing how signals are processed inside cells.

Association of CNR1 Gene with Schizophrenia

Scientists are becoming more interested in how the CNR1 gene is related to schizophrenia. Schizophrenia is a complex mental illness that affects people differently. It can cause various signs and people may respond differently to medications. Research suggests that while dopamine and glutamate are known to play big roles in schizophrenia, the disease may be more connected to the weed system.

Research on the CB1 cannabinoid receptor has found that it is closely related to the causes of schizophrenia. Using weed early in life, especially during teenage years, increases the risk of developing schizophrenia. When THC activates CB1 receptors, it can interfere with how neurotransmitters like dopamine, glutamate, and GABA work. This can lead to problems with thinking and emotions that are related to schizophrenia. Studies have found unusual amounts of natural cannabinoids, like anandamide, in people with schizophrenia. This suggests that the cannabinoid system may play a role in the early stages of schizophrenia.

Changes in the CNR1 gene are believed to impact the chance of developing schizophrenia. Certain variations in a single gene called CNR1 are linked to how often schizophrenia occurs, how it shows itself, and how patients respond to treatment. The results are still confusing, and the connection between the CNR1 gene and schizophrenia is still being debated. Therefore, more research on the CNR1 gene as a possible risk factor for schizophrenia is recommended.

Molecular Mechanisms and Physiological Functions of the CNR1 Gene

The CB1 receptor is a type of G protein-coupled receptor (GPCR) that has a complex way of sending signals. Activating the CB1 receptor mainly reduces cAMP levels inside the cell through Gi-type G proteins. This affects several cellular processes like neural learning, the release of neurotransmitters, and how excited neurons can become. CB1 receptors play a key role in controlling how signals are sent between brain cells, as well as in learning and memory, especially in the hippocampus and cerebral cortex. Both external cannabinoids, like THC, and internal ones, like anandamide and 2-arachidonoylglycerol, activate CB1 receptors.

Active CB1 receptors in the brain may regulate energy use and hunger. Research shows that the CB1 receptor increases food consumption by producing a substance called β-endorphin. The CB1 receptor helps control fat metabolism. When it is activated in the liver and fat tissue, it can increase fat production and decrease fat breakdown. The role of the CB1 receptor in metabolic syndrome and prolonged stress is becoming clearer. This could lead to new ways to treat diabetes, obesity, and other metabolic issues.

CB1 Receptor and Pain Regulation

The CB1 receptor is important for how we feel and manage pain. Cannabinoids block pain transmission by activating CB1 receptors, especially in the nociceptive circuits of the periphery and central nervous systems. The CB1 receptor helps reduce pain signals and might also influence how we feel pain by interacting with other pain receptors, like TRPV1 receptors. Research shows that when CB1 receptors are activated, they can lower the activity of TRPV1 receptors, which helps decrease pain from outside sources. Cannabinoids might be useful for treating pain, especially long-lasting and inflammation pain.

How we feel and manage pain relies heavily on the CB1 receptor. Especially in nociceptive pathways of the peripheral and central nerve systems, cannabis decreases pain transmission by binding CB1 receptors. Besides stopping pain signals directly, the CB1 receptor may also affect how we feel pain by interacting with other pain receptors like TRPV1. Studies on CB1 receptor activity suggest that it can reduce the production and stimulation of TRPV1 receptors, which helps lessen pain from external sources. Cannabis chemicals could potentially help relieve pain, especially in cases of inflammation and prolonged pain.

Connection Between the Cannabinoid System and the Digestive System

The cannabis system is important not only for the central nervous system but also for regulating digestion. CB1 receptors are common in endocrine cells and nerves in the gut. They help regulate how the gut moves and processes food. Activating CB1 receptors changes how smooth muscles contract, how endocrine cells produce hormones, and how neurotransmitters are released in the digestive system. This affects appetite, hunger, and digestion. CB1 receptors may play a role in how we feel pain in the digestive system, and they could be used as targets for treating conditions like irritable bowel syndrome and long-term digestive problems.

The CNR1 gene and its connection to other diseases.

The CNR1 gene is connected to various metabolic and immune system diseases, as well as mental health disorders such as worry and schizophrenia. For instance, activating the CB1 receptor may trigger inflammation linked to the NLRP3 inflammasome, which is connected to type 2 diabetes and problems with pancreatic β-cells. Research shows that the CB1 receptor in the liver and fat tissues likely plays a big role in causing these metabolic diseases.

CB1 receptors are closely linked to various immune system functions. CB1 receptors in immune cells help manage inflammation, which in turn influences how the immune system responds. This discovery opens new possibilities for immunotherapy, especially in research on inflammatory diseases where CB1 receptors could become key targets for treatment.

References:

  1. Benyamina A, Kebir O, et al. CNR1 gene polymorphisms in addictive disorders: a systematic review and a meta-analysis. Addict Biol. 2011 Jan;16(1):1-6.
  2. Gouvêa ES, Santos AF Filho, et al. The role of the CNR1 gene in schizophrenia: a systematic review including unpublished data. Braz J Psychiatry. 2017 Apr-Jun;39(2):160-171.
  3. Sharkey KA, Wiley JW. The Role of the Endocannabinoid System in the Brain-Gut Axis. Gastroenterology. 2016 Aug;151(2):252-66.
Quick Inquiry