Transfected Stable Cell Lines
Reliable | High-Performance | Wide Rage
Precision reporter, kinase, immune receptor, biosimilar, Cas9, and knockout stable cell lines for diverse applications.
Cat. No. : PMRNL-0006
| Cat. No. | PMRNL-0006 |
| Description | The mCherry mRNA encodes the mCherry fluorescent protein, which can be used as a fluorescent tracer in transfection and transgenic experiments or as a reporter of gene expression. The incorporation of N1-methylpseudouridine can reduce the immunogenicity of the resulting mRNA. |
| Gene Type | Reporter Gene |
| RNA Type | mRNA |
| Gene Name | mCherry |
| Features |
• mRNA synthesized on error free sequence verified plasmid DNA template • 100% replacement of UTP with modified nucleotides N1-Methylpseudo-UTP • Cap 1 Capping and poly-A tailed incorporated • Degrades the DNA template after RNA synthesis with DNase |
| Sequence | MASKLGSVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKLE |
| Storage | Store at or below -70°C. Avoid repeated freeze/thaw cycles. Aliquot if necessary using RNase-free equipment, reagents, pipet tips, tubes, and containers. |
If your question is not addressed through these resources, you can fill out the online form below and we will answer your question as soon as possible.
Write a review of your use of Biogene products and services in your research. Your review can help your fellow researchers make informed purchasing decisions.