Pages
Products

mCherry mRNA (N1-Methylpseudo-UTP modified)

For research use only. Not intended for any clinical use.

Cat. No. :   PMRNL-0006

Inquire for Price

Product Information

Cat. No. PMRNL-0006
Description The mCherry mRNA encodes the mCherry fluorescent protein, which can be used as a fluorescent tracer in transfection and transgenic experiments or as a reporter of gene expression. The incorporation of N1-methylpseudouridine can reduce the immunogenicity of the resulting mRNA.
Gene Type Reporter Gene
RNA Type mRNA
Gene Name mCherry
Features • mRNA synthesized on error free sequence verified plasmid DNA template
• 100% replacement of UTP with modified nucleotides N1-Methylpseudo-UTP
• Cap 1 Capping and poly-A tailed incorporated
• Degrades the DNA template after RNA synthesis with DNase
Sequence MASKLGSVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKLE
Storage Store at or below -70°C. Avoid repeated freeze/thaw cycles. Aliquot if necessary using RNase-free equipment, reagents, pipet tips, tubes, and containers.
Quick Inquiry

Q & A

Customer Reviews

Ask a Question

If your question is not addressed through these resources, you can fill out the online form below and we will answer your question as soon as possible.

Write a Review

Write a review of your use of Biogene products and services in your research. Your review can help your fellow researchers make informed purchasing decisions.

Needs improvement

Satisfaction

General satisfaction

Very satisfaction