IL15

Official Full Name

interleukin 15

Organism

Homo sapiens

Gene ID

3600

Background

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported. [provided by RefSeq, Feb 2011]

Synonyms

IL-15

Bio Chemical Class

Cytokine: interleukin

Protein Sequence

MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Open

Disease

Coeliac disease, Human immunodeficiency virus disease, Mature T-cell lymphoma, Mycosis fungoides, Rheumatoid arthritis, Solid tumour/cancer

Approved Drug

Clinical Trial Drug

5 +

Discontinued Drug

Cat.No.	Product Name	Price
CSC-DC007540	Panoply™ Human IL15 Knockdown Stable Cell Line	Inquiry
CSC-SC007540	Panoply™ Human IL15 Over-expressing Stable Cell Line	Inquiry

Cat.No.	Product Name	Price
AD08006Z	Human IL15 adenoviral particles	Inquiry
LV15341L	human IL15 (NM_000585) lentivirus particles	Inquiry
LV15342L	human IL15 (NM_172175) lentivirus particles	Inquiry

Cat.No.	Product Name	Price
SHH318261	shRNA set against Human IL15 (NM_000585.4)	Inquiry
SHH318265	shRNA set against Mouse IL15 (NM_008357.2)	Inquiry
SHH318269	shRNA set against Rat IL15 (NM_013129.2)	Inquiry
SHL171036	shRNA set against Rat Il15(NM_013129.2)	Inquiry
SHW005083	shRNA set against Chicken IL15 (NM_204571)	Inquiry
SHW009510	shRNA set against Danio rerio IL15 (NM_001039565)	Inquiry

Cat.No.	Product Name	Price
RP00665	Recombinant Human IL-15 (C-Fc)	Inquiry

Cat.No.	Product Name	Price
CDFR010928	Rat Il15 cDNA Clone(NM_013129.2)	Inquiry
MiUTR1M-05971	IL15 miRNA 3'UTR clone	Inquiry
MiUTR1R-02627	IL15 miRNA 3'UTR clone	Inquiry
CDCB156763	Cynomolgus IL15 ORF clone	Inquiry
CDCB157300	Mouse IL15 ORF clone (NM_008357.1)	Inquiry
CDCB166558	Chicken IL15 ORF Clone (NM_204571)	Inquiry
CDCB170985	Danio rerio IL15 ORF Clone (NM_001039565)	Inquiry
CDCB180795	Rabbit IL15 ORF clone (XM_008267272.1)	Inquiry
CDCL183272	Human CD282 ORF clone(NM_003264.3)	Inquiry
CDCL184767	Rat IL15 ORF clone(NM_013129.2)	Inquiry
CDCS405770	Human IL15 ORF Clone (BC018149)	Inquiry

Detailed Information

Interleukins 15 (IL-15) plays pleiotropic biological functions including dictating T cell response, regulating tissue repair and B cell homing, modulating inflammation, and activating NK cells. Thus, it is considered as a potential therapeutic target in diseases such as obesity, type 2 diabetes (T2D), cancer and T cell immunity responses.

IL-15 signaling

It is generally accepted that IL-15 effects its biological function via two signaling pathways, one called classical signaling and another called tran-signaling (Figure 1).

IL-15 Figure 1. IL-15 signaling pathway. (Guo Y, et al. 2017)

It has been shown that IL-15-mediated its signals via binding to IL-15 receptor, which consists of β and γ subunits. Upon binding of IL-15 to IL-15 receptor in responding cells, the Janus kinase 1 (Jak1) and Jak3 is phosphorylated and activated respectively. Activated Jak1 and Jak3 further leads to phosphorylation of signal transducer and activator of transcription proteins 3 and 5 (STAT3 and STAT5), which activates downstream signaling molecules such as PI3K/AKT and Ras/Raf MAP kinase that might mediate the gene transcriptional regulation of IL-15. Although IL-15 is presented by high affinity receptor α, it can bind to the intermediate-affinity β and γ receptor complex without receptor α in some case, activating other tyrosine kinases including lymphocyte-specific protein tyrosine kinase (Lck), Fyn, Lyn, Spleen tyrosine kinase (Syk) and cross talk with the PI3K and mitogen-activated protein kinase (MAPK) pathways.

Roles of IL-15

IL-15 Figure 2. Pleiotropic biological roles of IL-15 on cells. (Patidar M, et al. 2016)

Studies have found that IL-15 exerts its functions on various cells including immunological cells and non-immune cells. It has been shown that IL-15 is implicated with activation of T cells that is critical for adaptive immune response. IL-15 has been demonstrated to effect on the survival of naive and memory CD8⁺ T cell. Several studies have reported that IL-15 maintains memory T cell response by inhibiting the activation induced cell death (AICD) of effector T cells which is induced by IL-2. Moreover, it has been shown that IL-15 alters the expression of CCR7 and CD62L to regulate T-cell migration resisting infection.

Additionally, IL-15 also acts the inhibition of apoptosis on B cells via promoting survival signal pathway IL-15–SyK–PCL1 and inhibiting anti-IgM-induced apoptosis. Moreover, studies have shown that IL-15 signals, such as IL-15–STAT5 and IL-15–SHC–Ras–Raf–ERK, are implicated with B cell proliferation, class-switching as well as antibody secretion. For instance, IL-15 enhances the proliferation of anti-HIV B-cells and Ig production in case of HIV. Based on these roles, IL-15 is considered as a useful target in humoral response. IL-15 also has been found to regulate B cell homing via inhibiting cytoskeletal rearrangement and migration.

In addition, it has been found that IL-15 is involved in the survival, maturation, proliferation, and anti-viral activity of NK cells. Upon binding of IL-15 to IL-15R on NK cells, three pathways including the Ras–Raf–MAP kinase, STAT5, and mammalian target of rapamycin (mTOR) pathways are evoked depending on the status of NK cells and infection conditions. Studies also found that activation of IL-15 on dendritic cells stimulates the cytotoxic as well as antitumor activity of NK cells.

Moreover, other immunological cells such as mast cell, dendritic cells and neutrophils are also influenced by IL-15. It has been shown that IL-15 activates neutrophils by stimulating RNA synthesis, cytoskeletal rearrangement, and morphological changes, and regulates phagocytosis of neutrophils by controlling Syk expression. Previous studies have found that IL-15 binds to IL-15RX, a unique receptor of IL-15 on mast cell, inducing mast cell growth by activation of JAK2/STAT5 pathways and differentiation by TYK2/STAT6/IL-4 pathway.

References:

Patidar M, et al. Interleukin 15: A key cytokine for immunotherapy. Cytokine & Growth Factor Reviews, 2016, 31:49-59.
Robinson T O, et al. The potential and promise of IL-15 in immuno-oncogenic therapies. Immunology Letters, 2017, 190:159-168.
Guo Y, et al. Immunobiology of the IL-15/IL-15Rα complex as an antitumor and antiviral agent. Cytokine Growth Factor Rev, 2017.
Chłopek M, et al. The role of interleukin 15 in neoplasia. Postepy Higieny I Medycyny Doswiadczalnej, 2017, 71:5.
Duan Y, et al. Interleukin-15 in obesity and metabolic dysfunction: current understanding and future perspectives. Obesity Reviews An Official Journal of the International Association for the Study of Obesity, 2017, 18(10).
Rautela J, et al. IL-15 signaling in NK cell cancer immunotherapy. Current Opinion in Immunology, 2016, 44:1.

Quick Inquiry

IL15

You might be looking for:

Detailed Information